General Information

  • ID:  hor004678
  • Uniprot ID:  Q9LI64(142-157)
  • Protein name:  Root meristem growth factor 4
  • Gene name:  GLV3
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  RGF family
  • Source:  Plant
  • Expression:  In roots, restricted to the root apical meristem (RAM) in a pattern positioned just above the quiescent center (QC), mainly in endodermis, cortex and vascular tissues, with strongest levels within cells in the QC vicinity . |Expressed in roots, specifical
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0009958 positive gravitropism; GO:0030154 cell differentiation; GO:2000280 regulation of root development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DYPIYSKPRRKPPVNN
  • Length:  16(142-157)
  • Propeptide:  MMRFTIIVIAFLLIIQSLEEEHILVYAHEGGEAGHKSLDYQGDQDSSTLHPKELFDAPRKVRFGRTTRAEKEQVTAMNNDSWSFKISGEHKQTNILADHDTTKNTFCKKMMIIVNDLTSLPTLEPSTSTNDMEKLARLLRDDYPIYSKPRRKPPVNNRAPDKF
  • Signal peptide:  MMRFTIIVIAFLLIIQSLEE
  • Modification:  T2 Sulfotyrosine;T13 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Maintains the postembryonic root stem cell niche.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LI64-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004678_AF2.pdbhor004678_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 221193 Formula: C88H138N26O24
Absent amino acids: ACEFGHLMQTW Common amino acids: P
pI: 10.45 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -177.5 Boman Index: -5766
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 42.5
Instability Index: 6282.5 Extinction Coefficient cystines: 2980
Absorbance 280nm: 198.67

Literature

  • PubMed ID:  NA
  • Title:  NA